PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000258167
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 723aa    MW: 78308.7 Da    PI: 5.961
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000258167genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.35.2e-52351621128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+evdiyk+ePwdL  k ++k++++e+yfFs  d+ky +g r nrat++gyWkatg+d++v++
  MDP0000258167  35 LAPGFRFHPTDEELVIYYLKRKVCRKPFKF-NAISEVDIYKSEPWDLAdKsSLKSRDQEYYFFSALDRKYGNGARMNRATNQGYWKATGNDRPVKH 129
                    579**************************9.89**************75347888999************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +vg+kktLvf++grap+g++t+Wvmheyrl
  MDP0000258167 130 -NDIVVGMKKTLVFHSGRAPDGKRTNWVMHEYRL 162
                    .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-5933187IPR003441NAC domain
PROSITE profilePS5100556.235187IPR003441NAC domain
PfamPF023653.2E-2637162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MGREADLQII ASAAADVAVA APLVPPTLPP APTALAPGFR FHPTDEELVI YYLKRKVCRK  60
PFKFNAISEV DIYKSEPWDL ADKSSLKSRD QEYYFFSALD RKYGNGARMN RATNQGYWKA  120
TGNDRPVKHN DIVVGMKKTL VFHSGRAPDG KRTNWVMHEY RLVDEVFEKA GLGAIQDAFV  180
LCRVFHKSNI GPPNGHRYAP FVEEEWDDDD KLTLVPGQET RTVAVVSRDA FVVGNGHAAC  240
XEQNDYAAGN EQKVHAAGSE QKVHAARSEQ NGLSAYIRGN GHAAYTGGNG HAAHIGGNGH  300
AVXIGGNGXA AYNGENGXGT SVEGNGHGTS MEGIAHGTSV EXTGHGTSVK GSGHSTSVEG  360
RGXXTSVERN GHGTSVEGSG HRTSVEENGH GISVEGNVVE GIGHGAIIVV DDNGTTNEGD  420
CHETCTAGNG HSVPSXENNI EQGDKKTIIV TWIELFERPG GEGEVLKRPN EICRAIXVVQ  480
NTQAISKAIV VVPELPAENX TVLPPCKTEK TDDYPMTCVV NREERLDDYP SPGPDDAQPL  540
LTLFNRQPGQ LRQYKRRRHN DSNSNHSNAS EISSGMTHDP CSSTTTTAST EASMTTTRNF  600
LSALVEYQLL ESLEPKDTTP APPPELNAAL MESSVPTSCL KYIETLQTEI HKISIERETL  660
KFEMMSAQAM INILQARIDL LNKENEDLKK KYKVVLRSDG SNNGGGGGGG DMMVKMVITM  720
VEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-45241899170NAC domain-containing protein 19
3swm_B1e-45241899170NAC domain-containing protein 19
3swm_C1e-45241899170NAC domain-containing protein 19
3swm_D1e-45241899170NAC domain-containing protein 19
3swp_A1e-45241899170NAC domain-containing protein 19
3swp_B1e-45241899170NAC domain-containing protein 19
3swp_C1e-45241899170NAC domain-containing protein 19
3swp_D1e-45241899170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.65320.0bud| fruit| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008375621.10.0PREDICTED: uncharacterized protein LOC103438860
TrEMBLM5XMB00.0M5XMB0_PRUPE; Uncharacterized protein
STRINGGLYMA20G33430.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.13e-93NAC domain containing protein 52